PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo24G0002200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family TALE
Protein Properties Length: 363aa    MW: 41386.4 Da    PI: 7.4707
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo24G0002200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.2e-092602952055
                      HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  Spipo24G0002200 260 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 295
                      4679*****************************885 PP

2ELK41.13.7e-14215236122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELKh+Ll+KY+gyL+sLkqEFs
  Spipo24G0002200 215 ELKHHLLKKYGGYLSSLKQEFS 236
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.3E-2272116IPR005540KNOX1
PfamPF037902.8E-2273115IPR005540KNOX1
SMARTSM012563.2E-28123174IPR005541KNOX2
PfamPF037912.9E-24129173IPR005541KNOX2
SMARTSM011882100132152IPR005539ELK domain
PROSITE profilePS5121311.662215235IPR005539ELK domain
SMARTSM011888.4E-8215236IPR005539ELK domain
PfamPF037897.8E-11215236IPR005539ELK domain
PROSITE profilePS5007113.102235298IPR001356Homeobox domain
SuperFamilySSF466897.7E-20236311IPR009057Homeodomain-like
SMARTSM003891.8E-13237302IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-27240300IPR009057Homeodomain-like
CDDcd000864.47E-12247299No hitNo description
PfamPF059201.0E-16255294IPR008422Homeobox KN domain
PROSITE patternPS000270273296IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MQQRHIPDNS TSATSSNKHI PLNPFQLISE AAFQPPVKTE GGSSYGHQQR QFNYAFSARA  60
GGEGSHSSGD MDAIKAKIIS HPQYSSLLEA YMDCQKVGSP PEVAARLAAV AREFESRRRA  120
ALGCRDPPSD PELDQFMEAY HDMLVKYKEE LTRPLNEAMD FLRRVESQLN ALTNGSSRSL  180
SDEKCEGVGS SEEDPDTIMG DAKLAGMDPR TEDRELKHHL LKKYGGYLSS LKQEFSKKKK  240
KGKLPKEARQ KLLNWWELHY KWPYPSESEK VALAESTGLD QKQINNWFIN QRKRHWKPSE  300
DMQFVVMDGY HPQNAAAALY MDGHFLGDGM YRLGPKHLDE EDEDWKSRYQ RRHEIIRRLS  360
NP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00675ChIP-seqTransfer from GRMZM2G017087Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002285521.11e-153PREDICTED: homeobox protein knotted-1-like 2
SwissprotQ413301e-142KN1_SOLLC; Homeotic protein knotted-1
TrEMBLF6H1591e-153F6H159_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g08380.t011e-153(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-110KNOTTED-like from Arabidopsis thaliana